Lineage for d1zm4a2 (1zm4 A:2-343)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries)
    Uniprot P32324
  8. Domain d1zm4a2: 1zm4 A:2-343 [125317]
    Other proteins in same PDB: d1zm4a1, d1zm4a3, d1zm4a4, d1zm4a5, d1zm4b_, d1zm4c1, d1zm4c3, d1zm4c4, d1zm4c5, d1zm4d_, d1zm4e1, d1zm4e3, d1zm4e4, d1zm4e5, d1zm4f_
    automated match to d1n0vc2
    complexed with tad

Details for d1zm4a2

PDB Entry: 1zm4 (more details), 2.9 Å

PDB Description: Structure of the eEF2-ETA-bTAD complex
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d1zm4a2:

Sequence, based on SEQRES records: (download)

>d1zm4a2 c.37.1.8 (A:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk
deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv
tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart
vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm
drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle
kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d1zm4a2 c.37.1.8 (A:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
lkvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d1zm4a2 are not available.

Timeline for d1zm4a2:

Domains from same chain:
(mouse over for more information)
d1zm4a1, d1zm4a3, d1zm4a4, d1zm4a5
Domains from other chains:
(mouse over for more information)
d1zm4b_, d1zm4c1, d1zm4c2, d1zm4c3, d1zm4c4, d1zm4c5, d1zm4d_, d1zm4e1, d1zm4e2, d1zm4e3, d1zm4e4, d1zm4e5, d1zm4f_