![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
![]() | Protein automated matches [226946] (29 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries) |
![]() | Domain d1zm3e1: 1zm3 E:344-481 [125310] Other proteins in same PDB: d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3b_, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3d_, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5, d1zm3f_ automated match to d1n0ua1 |
PDB Entry: 1zm3 (more details), 3.07 Å
SCOPe Domain Sequences for d1zm3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm3e1 b.43.3.0 (E:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d1zm3e1:
![]() Domains from same chain: (mouse over for more information) d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5 |