Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) Uniprot P32324 |
Domain d1zm3a4: 1zm3 A:482-560 [125301] Other proteins in same PDB: d1zm3a1, d1zm3a2, d1zm3a3, d1zm3b1, d1zm3c1, d1zm3c2, d1zm3c3, d1zm3d1, d1zm3e1, d1zm3e2, d1zm3e3, d1zm3f1 automatically matched to d1n0ua4 |
PDB Entry: 1zm3 (more details), 3.07 Å
SCOPe Domain Sequences for d1zm3a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm3a4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d1zm3a4:
View in 3D Domains from same chain: (mouse over for more information) d1zm3a1, d1zm3a2, d1zm3a3, d1zm3a5 |