Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255013] (5 PDB entries) |
Domain d1zm2e3: 1zm2 E:561-725 [125294] Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a4, d1zm2a5, d1zm2b_, d1zm2c1, d1zm2c2, d1zm2c4, d1zm2c5, d1zm2d_, d1zm2e1, d1zm2e2, d1zm2e4, d1zm2e5, d1zm2f_ automated match to d1n0ua3 complexed with apr |
PDB Entry: 1zm2 (more details), 3.07 Å
SCOPe Domain Sequences for d1zm2e3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm2e3 d.14.1.0 (E:561-725) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d1zm2e3:
View in 3D Domains from same chain: (mouse over for more information) d1zm2e1, d1zm2e2, d1zm2e4, d1zm2e5 |