Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (26 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries) |
Domain d1zm2e1: 1zm2 E:344-481 [125292] Other proteins in same PDB: d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2b_, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2d_, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5, d1zm2f_ automated match to d1n0ua1 complexed with apr |
PDB Entry: 1zm2 (more details), 3.07 Å
SCOPe Domain Sequences for d1zm2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm2e1 b.43.3.0 (E:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d1zm2e1:
View in 3D Domains from same chain: (mouse over for more information) d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5 |