Lineage for d1zm2e1 (1zm2 E:344-481)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793315Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)
  8. 2793318Domain d1zm2e1: 1zm2 E:344-481 [125292]
    Other proteins in same PDB: d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2b_, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2d_, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5, d1zm2f_
    automated match to d1n0ua1
    complexed with apr

Details for d1zm2e1

PDB Entry: 1zm2 (more details), 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm2e1 b.43.3.0 (E:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d1zm2e1:

Click to download the PDB-style file with coordinates for d1zm2e1.
(The format of our PDB-style files is described here.)

Timeline for d1zm2e1: