![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) Uniprot P32324 |
![]() | Domain d1zm2c5: 1zm2 C:726-842 [125290] Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a3, d1zm2b1, d1zm2c1, d1zm2c2, d1zm2c3, d1zm2d1, d1zm2e1, d1zm2e2, d1zm2e3, d1zm2f1 automatically matched to d1n0ua5 complexed with apr, dde |
PDB Entry: 1zm2 (more details), 3.07 Å
SCOP Domain Sequences for d1zm2c5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm2c5 d.58.11.1 (C:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d1zm2c5:
![]() Domains from same chain: (mouse over for more information) d1zm2c1, d1zm2c2, d1zm2c3, d1zm2c4 |