Lineage for d1zm2c2 (1zm2 C:2-343)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein automated matches [190047] (37 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)
  8. Domain d1zm2c2: 1zm2 C:2-343 [125287]
    Other proteins in same PDB: d1zm2a1, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2b_, d1zm2c1, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2d_, d1zm2e1, d1zm2e3, d1zm2e4, d1zm2e5, d1zm2f_
    automated match to d1n0ua2
    complexed with apr

Details for d1zm2c2

PDB Entry: 1zm2 (more details), 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1zm2c2:

Sequence, based on SEQRES records: (download)

>d1zm2c2 c.37.1.8 (C:2-343) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk
deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv
tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart
vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm
drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle
kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d1zm2c2 c.37.1.8 (C:2-343) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
lkvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d1zm2c2 are not available.

Timeline for d1zm2c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zm2c1, d1zm2c3, d1zm2c4, d1zm2c5
View in 3D
Domains from other chains:
(mouse over for more information)
d1zm2a1, d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2b_, d1zm2d_, d1zm2e1, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5, d1zm2f_