Lineage for d1zm2b_ (1zm2 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2558215Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 2558216Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 2558232Domain d1zm2b_: 1zm2 B: [125285]
    Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2c1, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2e1, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5
    automated match to d1zm9b_
    complexed with apr

Details for d1zm2b_

PDB Entry: 1zm2 (more details), 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
PDB Compounds: (B:) exotoxin a

SCOPe Domain Sequences for d1zm2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm2b_ d.166.1.1 (B:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d1zm2b_:

Click to download the PDB-style file with coordinates for d1zm2b_.
(The format of our PDB-style files is described here.)

Timeline for d1zm2b_: