![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (5 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) |
![]() | Domain d1zm2a1: 1zm2 A:344-481 [125280] Other proteins in same PDB: d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2b1, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2d1, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5, d1zm2f1 automatically matched to d1n0ua1 complexed with apr, dde |
PDB Entry: 1zm2 (more details), 3.07 Å
SCOP Domain Sequences for d1zm2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm2a1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d1zm2a1:
![]() Domains from same chain: (mouse over for more information) d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5 |