Lineage for d1zm1b_ (1zm1 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388754Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2388755Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2388769Species Fibrobacter succinogenes [TaxId:833] [89270] (5 PDB entries)
    a natural circularly permuted protein
  8. 2388775Domain d1zm1b_: 1zm1 B: [125279]
    automated match to d1mvea_
    complexed with ca

Details for d1zm1b_

PDB Entry: 1zm1 (more details), 2.3 Å

PDB Description: crystal structures of complex f. succinogenes 1,3-1,4-beta-d-glucanase and beta-1,3-1,4-cellotriose
PDB Compounds: (B:) Beta-glucanase

SCOPe Domain Sequences for d1zm1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm1b_ b.29.1.2 (B:) Bacillus 1-3,1-4-beta-glucanase {Fibrobacter succinogenes [TaxId: 833]}
akdfsgaelytleevqygkfearmkmaaasgtvssmflyqngseiadgrpwvevdievlg
knpgsfqsniitgkagaqktsekhhavspaadqafhtyglewtpnyvrwtvdgqevrkte
ggqvsnltgtqglrfnlwssesaawvgqfdesklplfqfinwvkvykytpgqgeggsdft
ldwtdnfdtfdgsrwgkgdwtfdgnrvdltdkniysrdgmlilaltrkgqesf

SCOPe Domain Coordinates for d1zm1b_:

Click to download the PDB-style file with coordinates for d1zm1b_.
(The format of our PDB-style files is described here.)

Timeline for d1zm1b_: