Lineage for d1zm0b_ (1zm0 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799448Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)
  8. 1799465Domain d1zm0b_: 1zm0 B: [125277]
    Other proteins in same PDB: d1zm0a1
    automated match to d1eaza_

Details for d1zm0b_

PDB Entry: 1zm0 (more details), 2.1 Å

PDB Description: crystal structure of the carboxyl terminal ph domain of pleckstrin to 2.1 angstroms
PDB Compounds: (B:) Pleckstrin

SCOPe Domain Sequences for d1zm0b_:

Sequence, based on SEQRES records: (download)

>d1zm0b_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsve
snsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records): (download)

>d1zm0b_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsve
eeenlfeiitadevhyflqaatpkertewikaiqmasr

SCOPe Domain Coordinates for d1zm0b_:

Click to download the PDB-style file with coordinates for d1zm0b_.
(The format of our PDB-style files is described here.)

Timeline for d1zm0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zm0a1