SCOPe 2.08: Domain d1zm0a1: 1zm0 A:243-347

Lineage for d1zm0a1 (1zm0 A:243-347)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Pleckstrin [50740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)

8. Domain d1zm0a1: 1zm0 A:243-347 [125276]
   Other proteins in same PDB: d1zm0b_
   2nd PH domain

Details for d1zm0a1

PDB Entry: 1zm0, 2.1 Å

PDB Description: crystal structure of the carboxyl terminal ph domain of pleckstrin to 2.1 angstroms

PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d1zm0a1:

Sequence, based on SEQRES records:

>d1zm0a1 b.55.1.1 (A:243-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
gviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsves
nsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records):

>d1zm0a1 b.55.1.1 (A:243-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
gviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvee
enlfeiitadevhyflqaatpkertewikaiqmasr

Timeline for d1zm0a1:

• d1zm0a1 first appeared in SCOP 1.73
  
• d1zm0a1 appears in SCOPe 2.07