SCOP 1.73: Domain d1zlzb2: 1zlz B:91-205

Lineage for d1zlzb2 (1zlz B:91-205)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Escherichia coli [TaxId:562] [54722] (11 PDB entries)

8. Domain d1zlzb2: 1zlz B:91-205 [125275]
   Other proteins in same PDB: d1zlza1, d1zlzb1
   automatically matched to d1d5na2
   complexed with azi, mh2; mutant

Details for d1zlzb2

PDB Entry: 1zlz, 1.55 Å

PDB Description: re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase

PDB Compounds: (B:) superoxide dismutase

SCOP Domain Sequences for d1zlzb2:

Sequence; same for both SEQRES and ATOM records:

>d1zlzb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1zlzb2:

• d1zlzb2 is new in SCOP 1.73
  
• d1zlzb2 appears in SCOP 1.75
  
• d1zlzb2 appears in the current release, SCOPe 2.08