Lineage for d1zlzb2 (1zlz B:91-205)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946154Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)
  8. 2946170Domain d1zlzb2: 1zlz B:91-205 [125275]
    Other proteins in same PDB: d1zlza1, d1zlzb1
    automated match to d1ixba2
    complexed with azi, mh2

Details for d1zlzb2

PDB Entry: 1zlz (more details), 1.55 Å

PDB Description: re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1zlzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlzb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d1zlzb2:

Click to download the PDB-style file with coordinates for d1zlzb2.
(The format of our PDB-style files is described here.)

Timeline for d1zlzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zlzb1