SCOPe 2.08: Domain d1zlza2: 1zlz A:91-205

Lineage for d1zlza2 (1zlz A:91-205)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)

8. Domain d1zlza2: 1zlz A:91-205 [125273]
   Other proteins in same PDB: d1zlza1, d1zlzb1
   automated match to d1ixba2
   complexed with azi, mh2

Details for d1zlza2

PDB Entry: 1zlz, 1.55 Å

PDB Description: re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1zlza2:

Sequence; same for both SEQRES and ATOM records:

>d1zlza2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1zlza2:

• d1zlza2 first appeared in SCOP 1.73
  
• d1zlza2 appears in SCOPe 2.07