SCOPe 2.03: Domain d1zlza1: 1zlz A:1-90

Lineage for d1zlza1 (1zlz A:1-90)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)

8. Domain d1zlza1: 1zlz A:1-90 [125272]
   Other proteins in same PDB: d1zlza2, d1zlzb2
   automated match to d1ixba1
   complexed with azi, mh2

Details for d1zlza1

PDB Entry: 1zlz, 1.55 Å

PDB Description: re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1zlza1:

Sequence; same for both SEQRES and ATOM records:

>d1zlza1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

Timeline for d1zlza1:

• d1zlza1 first appeared in SCOP 1.73
  
• d1zlza1 appears in SCOPe 2.02
  
• d1zlza1 appears in SCOPe 2.04
  
• d1zlza1 appears in the current release, SCOPe 2.08