SCOPe 2.04: Domain d1zlwm2: 1zlw M:114-227

Lineage for d1zlwm2 (1zlw M:114-227)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1zlwm2: 1zlw M:114-227 [125269]
   Other proteins in same PDB: d1zlwh1, d1zlwk1, d1zlwk2, d1zlwl1, d1zlwl2, d1zlwm1
   automatically matched to d1aqkh2
   complexed with man

Details for d1zlwm2

PDB Entry: 1zlw, 2.85 Å

PDB Description: fab 2g12 + man8

PDB Compounds: (M:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d1zlwm2:

Sequence, based on SEQRES records:

>d1zlwm2 b.1.1.2 (M:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1zlwm2 b.1.1.2 (M:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfaalgclvkdyfpepvtvswnsaltsgvhtfpavlqssglyslssvvtvpss
slgtqtyicnvnhkpsntkvdkkvep

Timeline for d1zlwm2:

• d1zlwm2 first appeared in SCOP 1.73
  
• d1zlwm2 appears in SCOPe 2.03
  
• d1zlwm2 appears in SCOPe 2.05
  
• d1zlwm2 last appears in SCOPe 2.07