Lineage for d1zlqb_ (1zlq B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1390578Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1391202Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 1391203Species Escherichia coli [TaxId:562] [102695] (18 PDB entries)
  8. 1391216Domain d1zlqb_: 1zlq B: [125254]
    automated match to d1uiva_
    complexed with act, cl, dtt, edt, fe, gol, so4

Details for d1zlqb_

PDB Entry: 1zlq (more details), 1.8 Å

PDB Description: Crystallographic and spectroscopic evidence for high affinity binding of Fe EDTA (H2O)- to the periplasmic nickel transporter NikA
PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d1zlqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlqb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikpv

SCOPe Domain Coordinates for d1zlqb_:

Click to download the PDB-style file with coordinates for d1zlqb_.
(The format of our PDB-style files is described here.)

Timeline for d1zlqb_: