Lineage for d1zlqa1 (1zlq A:3-501)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879727Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 1879732Species Escherichia coli [TaxId:562] [102695] (18 PDB entries)
  8. 1879744Domain d1zlqa1: 1zlq A:3-501 [125253]
    complexed with act, cl, dtt, edt, fe, gol, so4

Details for d1zlqa1

PDB Entry: 1zlq (more details), 1.8 Å

PDB Description: Crystallographic and spectroscopic evidence for high affinity binding of Fe EDTA (H2O)- to the periplasmic nickel transporter NikA
PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d1zlqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlqa1 c.94.1.1 (A:3-501) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikpvk

SCOPe Domain Coordinates for d1zlqa1:

Click to download the PDB-style file with coordinates for d1zlqa1.
(The format of our PDB-style files is described here.)

Timeline for d1zlqa1: