SCOP 1.75: Domain d1zlqa1: 1zlq A:3-501

Lineage for d1zlqa1 (1zlq A:3-501)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (5 PDB entries)

8. Domain d1zlqa1: 1zlq A:3-501 [125253]
   complexed with act, cl, dtt, edt, fe, gol, so4

Details for d1zlqa1

PDB Entry: 1zlq, 1.8 Å

PDB Description: Crystallographic and spectroscopic evidence for high affinity binding of Fe EDTA (H2O)- to the periplasmic nickel transporter NikA

PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOP Domain Sequences for d1zlqa1:

Sequence; same for both SEQRES and ATOM records:

>d1zlqa1 c.94.1.1 (A:3-501) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikpvk

Timeline for d1zlqa1:

• d1zlqa1 first appeared in SCOP 1.73
  
• d1zlqa1 appears in SCOPe 2.01
  
• d1zlqa1 appears in the current release, SCOPe 2.08