Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins) |
Protein Nickel-binding periplasmic protein NikA [102694] (1 species) similar domain organization to oligo- and dipeptide-binding protein |
Species Escherichia coli [TaxId:562] [102695] (3 PDB entries) |
Domain d1zlqa1: 1zlq A:3-501 [125253] complexed with act, cl, dtt, edt, fe, gol, so4 |
PDB Entry: 1zlq (more details), 1.8 Å
SCOP Domain Sequences for d1zlqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlqa1 c.94.1.1 (A:3-501) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]} pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn ipyapiateipfeqikpvk
Timeline for d1zlqa1: