SCOP 1.73: Domain d1zlba1: 1zlb A:1-122

Lineage for d1zlba1 (1zlb A:1-122)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (4 PDB entries)

8. Domain d1zlba1: 1zlb A:1-122 [125248]
   automatically matched to d1umvx_

Details for d1zlba1

PDB Entry: 1zlb, 0.97 Å

PDB Description: crystal structure of catalytically-active phospholipase a2 in the absence of calcium

PDB Compounds: (A:) hypotensive phospholipase A2

SCOP Domain Sequences for d1zlba1:

Sequence; same for both SEQRES and ATOM records:

>d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc

Timeline for d1zlba1:

• d1zlba1 is new in SCOP 1.73
  
• d1zlba1 appears in SCOP 1.75
  
• d1zlba1 appears in the current release, SCOPe 2.08, called d1zlba_