SCOPe 2.04: Domain d1zlaf_: 1zla F:

Lineage for d1zlaf_ (1zla F:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (38 PDB entries)

8. Domain d1zlaf_: 1zla F: [125245]
   Other proteins in same PDB: d1zlaa_, d1zlac1, d1zlad_, d1zlae_, d1zlag_, d1zlah_
   automated match to d1kx5b_
   protein/DNA complex

Details for d1zlaf_

PDB Entry: 1zla, 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core

PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d1zlaf_:

Sequence; same for both SEQRES and ATOM records:

>d1zlaf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg

Timeline for d1zlaf_:

• d1zlaf_ first appeared in SCOP 1.73, called d1zlaf1
  
• d1zlaf_ appears in SCOPe 2.03
  
• d1zlaf_ appears in SCOPe 2.05
  
• d1zlaf_ appears in the current release, SCOPe 2.08