SCOPe 2.07: Domain d1zlae_: 1zla E:

Lineage for d1zlae_ (1zla E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)

8. Domain d1zlae_: 1zla E: [125244]
   Other proteins in same PDB: d1zlab_, d1zlac1, d1zlad_, d1zlaf_, d1zlag_, d1zlah_
   automated match to d1kx5a_
   protein/DNA complex

Details for d1zlae_

PDB Entry: 1zla, 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core

PDB Compounds: (E:) histone h3

SCOPe Domain Sequences for d1zlae_:

Sequence; same for both SEQRES and ATOM records:

>d1zlae_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvhimpkdiqlarrirgera

Timeline for d1zlae_:

• d1zlae_ first appeared in SCOP 1.73, called d1zlae1
  
• d1zlae_ appears in SCOPe 2.06
  
• d1zlae_ appears in the current release, SCOPe 2.08