Lineage for d1zlae1 (1zla E:638-735)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637576Protein Histone H3 [47122] (4 species)
  7. 637577Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (23 PDB entries)
  8. 637619Domain d1zlae1: 1zla E:638-735 [125244]
    Other proteins in same PDB: d1zlab1, d1zlac1, d1zlad1, d1zlaf1, d1zlag1, d1zlah1
    automatically matched to d1p3le_

Details for d1zlae1

PDB Entry: 1zla (more details), 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
PDB Compounds: (E:) histone h3

SCOP Domain Sequences for d1zlae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlae1 a.22.1.1 (E:638-735) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvhimpkdiqlarrirgera

SCOP Domain Coordinates for d1zlae1:

Click to download the PDB-style file with coordinates for d1zlae1.
(The format of our PDB-style files is described here.)

Timeline for d1zlae1: