Lineage for d1zlad1 (1zla D:1230-1322)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637506Protein Histone H2B [47119] (5 species)
  7. 637507Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)
  8. 637547Domain d1zlad1: 1zla D:1230-1322 [125243]
    Other proteins in same PDB: d1zlaa1, d1zlab1, d1zlae1, d1zlaf1
    automatically matched to d1s32d_

Details for d1zlad1

PDB Entry: 1zla (more details), 2.9 Å

PDB Description: X-ray Structure of a Kaposi's sarcoma herpesvirus LANA peptide bound to the nucleosomal core
PDB Compounds: (D:) histone h2b

SCOP Domain Sequences for d1zlad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlad1 a.22.1.1 (D:1230-1322) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1zlad1:

Click to download the PDB-style file with coordinates for d1zlad1.
(The format of our PDB-style files is described here.)

Timeline for d1zlad1: