SCOP 1.73: Domain d1zlac1: 1zla C:814-920

Lineage for d1zlac1 (1zla C:814-920)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)

8. Domain d1zlac1: 1zla C:814-920 [125242]
   Other proteins in same PDB: d1zlaa1, d1zlab1, d1zlae1, d1zlaf1

Details for d1zlac1

PDB Entry: 1zla, 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core

PDB Compounds: (C:) Xenopus laevis-like histone H2A

SCOP Domain Sequences for d1zlac1:

Sequence; same for both SEQRES and ATOM records:

>d1zlac1 a.22.1.1 (C:814-920) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

Timeline for d1zlac1:

• d1zlac1 is new in SCOP 1.73
  
• d1zlac1 appears in SCOP 1.75
  
• d1zlac1 appears in the current release, SCOPe 2.08