![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries) |
![]() | Domain d1zlaa_: 1zla A: [125240] Other proteins in same PDB: d1zlab_, d1zlac1, d1zlad_, d1zlaf_, d1zlag_, d1zlah_ automated match to d1kx5a_ protein/DNA complex |
PDB Entry: 1zla (more details), 2.9 Å
SCOPe Domain Sequences for d1zlaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlaa_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease aylvalfedtnlcaihakrvhimpkdiqlarrirgera
Timeline for d1zlaa_: