![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.194: L27 domain [101287] (1 superfamily) 6 helices, heterodimer of 3-helical domains |
![]() | Superfamily a.194.1: L27 domain [101288] (1 family) ![]() |
![]() | Family a.194.1.1: L27 domain [101289] (5 proteins) |
![]() | Protein Peripheral plasma membrane protein cask [101296] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140708] (2 PDB entries) |
![]() | Domain d1zl8b1: 1zl8 B:106-159 [125239] Other proteins in same PDB: d1zl8a1 |
PDB Entry: 1zl8 (more details)
SCOP Domain Sequences for d1zl8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zl8b1 a.194.1.1 (B:106-159) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]} sdavqrakevleeiscypenndakelkriltqphfmallqthdvvahevysdea
Timeline for d1zl8b1: