Lineage for d1zl8b1 (1zl8 B:106-159)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014536Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2014537Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2014538Family a.194.1.1: L27 domain [101289] (6 protein domains)
  6. 2014559Protein Peripheral plasma membrane protein cask [101296] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [140708] (1 PDB entry)
    Uniprot O14936 403-456
  8. 2014561Domain d1zl8b1: 1zl8 B:106-159 [125239]
    Other proteins in same PDB: d1zl8a1, d1zl8a2

Details for d1zl8b1

PDB Entry: 1zl8 (more details)

PDB Description: NMR structure of L27 heterodimer from C. elegans Lin-7 and H. sapiens Lin-2 scaffold proteins
PDB Compounds: (B:) Peripheral plasma membrane protein CASK

SCOPe Domain Sequences for d1zl8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl8b1 a.194.1.1 (B:106-159) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]}
sdavqrakevleeiscypenndakelkriltqphfmallqthdvvahevysdea

SCOPe Domain Coordinates for d1zl8b1:

Click to download the PDB-style file with coordinates for d1zl8b1.
(The format of our PDB-style files is described here.)

Timeline for d1zl8b1: