Lineage for d1zl8a1 (1zl8 A:4-53)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018595Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2018596Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2018597Family a.194.1.1: L27 domain [101289] (6 proteins)
  6. 2018605Protein Lin-7 [140709] (2 species)
  7. 2018609Species Nematode (Caenorhabditis elegans) [TaxId:6239] [140711] (1 PDB entry)
    Uniprot Q9U245 116-165
  8. 2018610Domain d1zl8a1: 1zl8 A:4-53 [125238]
    Other proteins in same PDB: d1zl8a2, d1zl8b1

Details for d1zl8a1

PDB Entry: 1zl8 (more details)

PDB Description: NMR structure of L27 heterodimer from C. elegans Lin-7 and H. sapiens Lin-2 scaffold proteins
PDB Compounds: (A:) lin-7

SCOPe Domain Sequences for d1zl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl8a1 a.194.1.1 (A:4-53) Lin-7 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
nlerdvqrilelmehvqktgevnnaklaslqqvlqseffgavrevyetvy

SCOPe Domain Coordinates for d1zl8a1:

Click to download the PDB-style file with coordinates for d1zl8a1.
(The format of our PDB-style files is described here.)

Timeline for d1zl8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zl8a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zl8b1