Lineage for d1zl8a1 (1zl8 A:4-53)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650912Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 650913Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 650914Family a.194.1.1: L27 domain [101289] (5 proteins)
  6. 650922Protein Lin-7 [140709] (2 species)
  7. 650923Species Caenorhabditis elegans [TaxId:6239] [140711] (1 PDB entry)
  8. 650924Domain d1zl8a1: 1zl8 A:4-53 [125238]
    Other proteins in same PDB: d1zl8b1

Details for d1zl8a1

PDB Entry: 1zl8 (more details)

PDB Description: NMR structure of L27 heterodimer from C. elegans Lin-7 and H. sapiens Lin-2 scaffold proteins
PDB Compounds: (A:) lin-7

SCOP Domain Sequences for d1zl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl8a1 a.194.1.1 (A:4-53) Lin-7 {Caenorhabditis elegans [TaxId: 6239]}
nlerdvqrilelmehvqktgevnnaklaslqqvlqseffgavrevyetvy

SCOP Domain Coordinates for d1zl8a1:

Click to download the PDB-style file with coordinates for d1zl8a1.
(The format of our PDB-style files is described here.)

Timeline for d1zl8a1:

650924
d1zl8a1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1zl8b1