Lineage for d1zl7a1 (1zl7 A:1-122)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 778048Protein Snake phospholipase A2 [48624] (35 species)
  7. 778111Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (4 PDB entries)
    Uniprot Q8AXY1 17-138
  8. 778113Domain d1zl7a1: 1zl7 A:1-122 [125237]
    automatically matched to d1umvx_
    complexed with ca, gol

Details for d1zl7a1

PDB Entry: 1zl7 (more details), 1.6 Å

PDB Description: crystal structure of catalytically-active phospholipase a2 with bound calcium
PDB Compounds: (A:) hypotensive phospholipase A2

SCOP Domain Sequences for d1zl7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl7a1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc

SCOP Domain Coordinates for d1zl7a1:

Click to download the PDB-style file with coordinates for d1zl7a1.
(The format of our PDB-style files is described here.)

Timeline for d1zl7a1: