Lineage for d1zl3a1 (1zl3 A:251-310)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680326Family b.122.1.1: PUA domain [88698] (5 proteins)
    RNA-binding domain
  6. 680349Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 680356Species Escherichia coli [TaxId:562] [88700] (3 PDB entries)
  8. 680359Domain d1zl3a1: 1zl3 A:251-310 [125235]
    Other proteins in same PDB: d1zl3a2
    automatically matched to d1r3fa1
    complexed with so4, ud5; mutant

Details for d1zl3a1

PDB Entry: 1zl3 (more details), 2.8 Å

PDB Description: Coupling of active site motions and RNA binding
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOP Domain Sequences for d1zl3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl3a1 b.122.1.1 (A:251-310) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli [TaxId: 562]}
ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv

SCOP Domain Coordinates for d1zl3a1:

Click to download the PDB-style file with coordinates for d1zl3a1.
(The format of our PDB-style files is described here.)

Timeline for d1zl3a1:

Domains from same chain:
(mouse over for more information)
d1zl3a2