![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
![]() | Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [88700] (3 PDB entries) |
![]() | Domain d1zl3a1: 1zl3 A:251-310 [125235] Other proteins in same PDB: d1zl3a2, d1zl3a3 automated match to d1r3fa1 protein/RNA complex; complexed with so4 |
PDB Entry: 1zl3 (more details), 2.8 Å
SCOPe Domain Sequences for d1zl3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zl3a1 b.122.1.1 (A:251-310) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli [TaxId: 562]} ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv
Timeline for d1zl3a1: