![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.32: gp9 [50016] (1 superfamily) consists of two different beta-sandwich domains unrelated to other beta-sandwich folds |
![]() | Superfamily b.32.1: gp9 [50017] (1 family) ![]() |
![]() | Family b.32.1.1: gp9 [50018] (1 protein) |
![]() | Protein gp9 [50019] (1 species) the trigger of tail contraction and the long tail fibers connector |
![]() | Species Bacteriophage T4 [TaxId:10665] [50020] (3 PDB entries) |
![]() | Domain d1zkuo1: 1zku O:1-288 [125227] automatically matched to d1qexa_ complexed with epe |
PDB Entry: 1zku (more details)
SCOP Domain Sequences for d1zkuo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkuo1 b.32.1.1 (O:1-288) gp9 {Bacteriophage T4 [TaxId: 10665]} mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
Timeline for d1zkuo1: