SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1zkuk1 (1zku K:1-288)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045293Fold b.32: gp9 [50016] (1 superfamily)
    consists of two different beta-sandwich domains unrelated to other beta-sandwich folds
  4. 2045294Superfamily b.32.1: gp9 [50017] (1 family) (S)
    automatically mapped to Pfam PF07880
  5. 2045295Family b.32.1.1: gp9 [50018] (1 protein)
  6. 2045296Protein gp9 [50019] (1 species)
    the trigger of tail contraction and the long tail fibers connector
  7. 2045297Species Bacteriophage T4 [TaxId:10665] [50020] (3 PDB entries)
  8. 2045312Domain d1zkuk1: 1zku K:1-288 [125223]
    automatically matched to d1qexa_
    complexed with epe

Details for d1zkuk1

PDB Entry: 1zku (more details), 15 Å

PDB Description: Fitting of the gp9 structure in the EM density of bacteriophage T4 extended tail
PDB Compounds: (K:) Baseplate structural protein Gp9

SCOPe Domain Sequences for d1zkuk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkuk1 b.32.1.1 (K:1-288) gp9 {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOPe Domain Coordinates for d1zkuk1:

Click to download the PDB-style file with coordinates for d1zkuk1.
(The format of our PDB-style files is described here.)

Timeline for d1zkuk1: