SCOPe 2.06: Domain d1zkui1: 1zku I:1-288

Lineage for d1zkui1 (1zku I:1-288)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.32: gp9 [50016] (1 superfamily)
   consists of two different beta-sandwich domains unrelated to other beta-sandwich folds

4. Superfamily b.32.1: gp9 [50017] (1 family)
   automatically mapped to Pfam PF07880

5. Family b.32.1.1: gp9 [50018] (1 protein)

6. Protein gp9 [50019] (1 species)
   the trigger of tail contraction and the long tail fibers connector

7. Species Bacteriophage T4 [TaxId:10665] [50020] (3 PDB entries)

8. Domain d1zkui1: 1zku I:1-288 [125221]
   automatically matched to d1qexa_
   complexed with epe

Details for d1zkui1

PDB Entry: 1zku, 15 Å

PDB Description: fitting of the gp9 structure in the em density of bacteriophage t4 extended tail

PDB Compounds: (I:) Baseplate structural protein Gp9

SCOPe Domain Sequences for d1zkui1:

Sequence; same for both SEQRES and ATOM records:

>d1zkui1 b.32.1.1 (I:1-288) gp9 {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

Timeline for d1zkui1:

• d1zkui1 first appeared in SCOP 1.73
  
• d1zkui1 appears in SCOPe 2.05
  
• d1zkui1 appears in SCOPe 2.07
  
• d1zkui1 appears in the current release, SCOPe 2.08