Class b: All beta proteins [48724] (165 folds) |
Fold b.32: gp9 [50016] (1 superfamily) consists of two different beta-sandwich domains unrelated to other beta-sandwich folds |
Superfamily b.32.1: gp9 [50017] (1 family) |
Family b.32.1.1: gp9 [50018] (1 protein) |
Protein gp9 [50019] (1 species) the trigger of tail contraction and the long tail fibers connector |
Species Bacteriophage T4 [TaxId:10665] [50020] (3 PDB entries) |
Domain d1zkuf1: 1zku F:1-288 [125218] automatically matched to d1qexa_ complexed with epe |
PDB Entry: 1zku (more details)
SCOP Domain Sequences for d1zkuf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkuf1 b.32.1.1 (F:1-288) gp9 {Bacteriophage T4 [TaxId: 10665]} mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
Timeline for d1zkuf1: