Lineage for d1zkud1 (1zku D:1-288)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664872Fold b.32: gp9 [50016] (1 superfamily)
    consists of two different beta-sandwich domains unrelated to other beta-sandwich folds
  4. 664873Superfamily b.32.1: gp9 [50017] (1 family) (S)
  5. 664874Family b.32.1.1: gp9 [50018] (1 protein)
  6. 664875Protein gp9 [50019] (1 species)
    the trigger of tail contraction and the long tail fibers connector
  7. 664876Species Bacteriophage T4 [TaxId:10665] [50020] (3 PDB entries)
  8. 664884Domain d1zkud1: 1zku D:1-288 [125216]
    automatically matched to d1qexa_
    complexed with epe

Details for d1zkud1

PDB Entry: 1zku (more details)

PDB Description: fitting of the gp9 structure in the em density of bacteriophage t4 extended tail
PDB Compounds: (D:) Baseplate structural protein Gp9

SCOP Domain Sequences for d1zkud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkud1 b.32.1.1 (D:1-288) gp9 {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOP Domain Coordinates for d1zkud1:

Click to download the PDB-style file with coordinates for d1zkud1.
(The format of our PDB-style files is described here.)

Timeline for d1zkud1: