Lineage for d1zkrb2 (1zkr B:73-144)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004029Fold a.101: Uteroglobin-like [48200] (1 superfamily)
    multihelical
  4. 2004030Superfamily a.101.1: Uteroglobin-like [48201] (1 family) (S)
    disulfide-linked dimer of two identical chains, 4 helices in each
  5. 2004031Family a.101.1.1: Uteroglobin-like [48202] (4 protein domains)
  6. 2004040Protein Allergen Fel d I-B chain [101361] (1 species)
    forms heterodimer with Fel d I-A chain
  7. 2004041Species Cat (Felis catus) [TaxId:9685] [101362] (3 PDB entries)
  8. 2004043Domain d1zkrb2: 1zkr B:73-144 [125212]
    Other proteins in same PDB: d1zkra1, d1zkrb1
    automated match to d1puoa2

Details for d1zkrb2

PDB Entry: 1zkr (more details), 1.64 Å

PDB Description: Crystal structure of the major cat allergen Fel d 1 (1+2)
PDB Compounds: (B:) Major allergen I polypeptide, fused chain 1, chain 2

SCOPe Domain Sequences for d1zkrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkrb2 a.101.1.1 (B:73-144) Allergen Fel d I-B chain {Cat (Felis catus) [TaxId: 9685]}
maetcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldgl
vmttissskdcm

SCOPe Domain Coordinates for d1zkrb2:

Click to download the PDB-style file with coordinates for d1zkrb2.
(The format of our PDB-style files is described here.)

Timeline for d1zkrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zkrb1