SCOPe 2.08: Domain d1zkrb2: 1zkr B:73-144

Lineage for d1zkrb2 (1zkr B:73-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.101: Uteroglobin-like [48200] (1 superfamily)
   multihelical

4. Superfamily a.101.1: Uteroglobin-like [48201] (2 families)
   disulfide-linked dimer of two identical chains, 4 helices in each

5. Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)

6. Protein Allergen Fel d I-B chain [101361] (1 species)
   forms heterodimer with Fel d I-A chain

7. Species Cat (Felis catus) [TaxId:9685] [101362] (3 PDB entries)

8. Domain d1zkrb2: 1zkr B:73-144 [125212]
   Other proteins in same PDB: d1zkra1, d1zkrb1
   automated match to d1puoa2

Details for d1zkrb2

PDB Entry: 1zkr, 1.64 Å

PDB Description: crystal structure of the major cat allergen fel d 1 (1+2)

PDB Compounds: (B:) Major allergen I polypeptide, fused chain 1, chain 2

SCOPe Domain Sequences for d1zkrb2:

Sequence; same for both SEQRES and ATOM records:

>d1zkrb2 a.101.1.1 (B:73-144) Allergen Fel d I-B chain {Cat (Felis catus) [TaxId: 9685]}
maetcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldgl
vmttissskdcm

Timeline for d1zkrb2:

• d1zkrb2 first appeared in SCOP 1.73
  
• d1zkrb2 appears in SCOPe 2.07