Lineage for d1zkrb1 (1zkr B:0-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721999Fold a.101: Uteroglobin-like [48200] (1 superfamily)
    multihelical
  4. 2722000Superfamily a.101.1: Uteroglobin-like [48201] (2 families) (S)
    disulfide-linked dimer of two identical chains, 4 helices in each
  5. 2722001Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)
  6. 2722002Protein Allergen Fel d I-A chain [101359] (1 species)
    forms heterodimer with Fel d I-B chain
  7. 2722003Species Cat (Felis catus) [TaxId:9685] [101360] (3 PDB entries)
  8. 2722007Domain d1zkrb1: 1zkr B:0-72 [125211]
    Other proteins in same PDB: d1zkra2, d1zkrb2
    automated match to d1puoa1

Details for d1zkrb1

PDB Entry: 1zkr (more details), 1.64 Å

PDB Description: crystal structure of the major cat allergen fel d 1 (1+2)
PDB Compounds: (B:) Major allergen I polypeptide, fused chain 1, chain 2

SCOPe Domain Sequences for d1zkrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkrb1 a.101.1.1 (B:0-72) Allergen Fel d I-A chain {Cat (Felis catus) [TaxId: 9685]}
meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
lldkiytsplcvk

SCOPe Domain Coordinates for d1zkrb1:

Click to download the PDB-style file with coordinates for d1zkrb1.
(The format of our PDB-style files is described here.)

Timeline for d1zkrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zkrb2