Class a: All alpha proteins [46456] (290 folds) |
Fold a.101: Uteroglobin-like [48200] (1 superfamily) multihelical |
Superfamily a.101.1: Uteroglobin-like [48201] (2 families) disulfide-linked dimer of two identical chains, 4 helices in each |
Family a.101.1.1: Uteroglobin-like [48202] (4 proteins) |
Protein Allergen Fel d I-B chain [101361] (1 species) forms heterodimer with Fel d I-A chain |
Species Cat (Felis catus) [TaxId:9685] [101362] (3 PDB entries) |
Domain d1zkra2: 1zkr A:73-145 [125210] Other proteins in same PDB: d1zkra1, d1zkrb1 automated match to d1puoa2 |
PDB Entry: 1zkr (more details), 1.64 Å
SCOPe Domain Sequences for d1zkra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkra2 a.101.1.1 (A:73-145) Allergen Fel d I-B chain {Cat (Felis catus) [TaxId: 9685]} maetcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldgl vmttissskdcmg
Timeline for d1zkra2: