SCOPe 2.06: Domain d1zkpb2: 1zkp B:0-244

Lineage for d1zkpb2 (1zkp B:0-244)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.9: YhfI-like [143924] (1 protein)
   part of Pfam PF00753

6. Protein Hypothetical protein BA1088 (BAS1016) [143925] (1 species)
   B. subtilis YhfI ortholog

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143926] (1 PDB entry)
   Uniprot Q81U06 1-244

8. Domain d1zkpb2: 1zkp B:0-244 [125206]
   Other proteins in same PDB: d1zkpa2, d1zkpb3, d1zkpc3, d1zkpd3
   automated match to d1zkpa1
   complexed with cl, na, zn

Details for d1zkpb2

PDB Entry: 1zkp, 1.5 Å

PDB Description: 1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease

PDB Compounds: (B:) hypothetical protein BA1088

SCOPe Domain Sequences for d1zkpb2:

Sequence; same for both SEQRES and ATOM records:

>d1zkpb2 d.157.1.9 (B:0-244) Hypothetical protein BA1088 (BAS1016) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amkmtvvgfwggfpeageatsgylfehdgfrllvdcgsgvlaqlqkyitpsdidavvlsh
yhhdhvadigvlqyarlitsatkgqlpelpiyghtfdengfhslthephtkgipynpeet
lqigpfsisflktvhpvtcfamritagndivvysadssyipefipftkdadlficecnmy
ahqeaakaghmnstevasiakdanvkelllthlphtgnpadlvteakqifsghitlahsg
yvwns

Timeline for d1zkpb2:

• d1zkpb2 first appeared in SCOP 1.73, called d1zkpb1
  
• d1zkpb2 was called d1zkpb_ in SCOPe 2.05
  
• d1zkpb2 appears in SCOPe 2.07
  
• d1zkpb2 appears in the current release, SCOPe 2.08