SCOPe 2.01: Domain d1zknd_: 1zkn D:

Lineage for d1zknd_ (1zkn D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (25 PDB entries)
   Uniprot Q08499 388-713

8. Domain d1zknd_: 1zkn D: [125204]
   automated match to d1oyna_
   complexed with ibm, mg, zn

Details for d1zknd_

PDB Entry: 1zkn, 2.1 Å

PDB Description: Structure of PDE4D2-IBMX

PDB Compounds: (D:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d1zknd_:

Sequence; same for both SEQRES and ATOM records:

>d1zknd_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

Timeline for d1zknd_:

• d1zknd_ first appeared in SCOP 1.73, called d1zknd1
  
• d1zknd_ was called d1zknd1 in SCOP 1.75
  
• d1zknd_ appears in SCOPe 2.02
  
• d1zknd_ appears in the current release, SCOPe 2.08