![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (6 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89152] (20 PDB entries) |
![]() | Domain d1zknd1: 1zkn D:79-412 [125204] automatically matched to d1oyna_ complexed with ibm, mg, zn |
PDB Entry: 1zkn (more details), 2.1 Å
SCOP Domain Sequences for d1zknd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zknd1 a.211.1.2 (D:79-412) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh plwetwadlvhpdaqdildtlednrewyqstipq
Timeline for d1zknd1: