Lineage for d1zkia1 (1zki A:4-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943884Protein Hypothetical protein PA5202 [143175] (1 species)
  7. 2943885Species Pseudomonas aeruginosa [TaxId:287] [143176] (1 PDB entry)
    Uniprot Q9HTY7 4-129
  8. 2943886Domain d1zkia1: 1zki A:4-129 [125199]
    complexed with acy

Details for d1zkia1

PDB Entry: 1zki (more details), 1.7 Å

PDB Description: structure of conserved protein pa5202 from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA5202

SCOPe Domain Sequences for d1zkia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]}
mpareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdvtmgla
cssshgfdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdklvakgq
gtfaql

SCOPe Domain Coordinates for d1zkia1:

Click to download the PDB-style file with coordinates for d1zkia1.
(The format of our PDB-style files is described here.)

Timeline for d1zkia1: