Lineage for d1zkha1 (1zkh A:1-86)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402278Protein Splicing factor 3 subunit 1, C-terminal domain [117799] (3 species)
  7. 1402279Species Human (Homo sapiens) [TaxId:9606] [142931] (1 PDB entry)
    Uniprot Q15459 704-789
  8. 1402280Domain d1zkha1: 1zkh A:1-86 [125198]

Details for d1zkha1

PDB Entry: 1zkh (more details)

PDB Description: Solution structure of a human ubiquitin-like domain in SF3A1
PDB Compounds: (A:) Splicing factor 3 subunit 1

SCOPe Domain Sequences for d1zkha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
pvsikvqvpnmqdktewklngqvlvftlpltdqvsvikvkiheatgmpagkqklqyegif
ikdsnslayynmangavihlalkerg

SCOPe Domain Coordinates for d1zkha1:

Click to download the PDB-style file with coordinates for d1zkha1.
(The format of our PDB-style files is described here.)

Timeline for d1zkha1: