Class a: All alpha proteins [46456] (285 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Transcriptional regulator TM1030 [140877] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140878] (8 PDB entries) Uniprot Q9X0C0 76-200 |
Domain d1zkgb2: 1zkg B:76-200 [125197] Other proteins in same PDB: d1zkga1, d1zkgb1 automated match to d1zkga2 complexed with unl |
PDB Entry: 1zkg (more details), 2.3 Å
SCOPe Domain Sequences for d1zkgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkgb2 a.121.1.1 (B:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk kgmtk
Timeline for d1zkgb2: